PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004499106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 323aa    MW: 36621.8 Da    PI: 9.0958
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004499106.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.1e-32155208255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_004499106.1 155 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 208
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15152208IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-28153208IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23155208IPR006447Myb domain, plants
PfamPF002492.0E-7156207IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MFTNNNNNNS HPIIMQRLFS PLLEPDLSLN ISPPSNISDS EAKEMETYKR VRTTSKPVYN  60
YNDISNSSTN SDSASSGSEL SHENVHNILH HHHHEPTLRL GFGNSCFNPQ YHHLHQQVQG  120
VSRNFNHHIQ PHIYGRDFKR SSRLVNGVKR SVRAPRMRWT TTLHAHFVHA VQLLGGHERA  180
TPKSVLELMN VKDLTLAHVK SHLQMYRTVK TTDKGTGHAQ TQGIFPLHGA NSSACERPNN  240
LPQPLQNSQR TSWQSSIETN TNNTEEKSEI GLTYSHLKGN DAMVDSTPLT RSNTMIDLEF  300
TLGRPNWEKD HAESSRELPL LKC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1579782e-56AC157978.25 Medicago truncatula clone mth2-47l16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004499106.10.0PREDICTED: probable transcription factor KAN4
SwissprotQ9FJV53e-65KAN4_ARATH; Probable transcription factor KAN4
TrEMBLG7I5881e-148G7I588_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA17G36500.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.12e-64G2-like family protein